PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400009184
Common NameLOC102600717
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 233aa    MW: 26917.8 Da    PI: 9.665
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400009184genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.64.4e-30959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krien++nrqvtf+kRrng+lKKA+ELSvLC+ae+a+i+fs++g++yeys+
  PGSC0003DMP400009184  9 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSTRGRVYEYSN 59
                          79***********************************************95 PP

2K-box99.45.3e-33791738100
                 K-box   8 s..leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                           +  ++e +a+ +qqe++kL+++i+++q+++Rhl+Ge+L+ L+++eL+qLe++Le+++++iRskK+e++l+++e+lqk+e  l++en  L
  PGSC0003DMP400009184  79 ActTQELNAQFYQQESKKLRQQIQMMQNSNRHLVGEGLSCLNVRELKQLENRLERGISRIRSKKHEMILAETENLQKREILLEQENAFL 167
                           23478899********************************************************************************* PP

                 K-box  95 rkklee 100
                           r+k++e
  PGSC0003DMP400009184 168 RSKIAE 173
                           ***986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.2E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.179161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.5E-32276IPR002100Transcription factor, MADS-box
CDDcd002651.27E-41274No hitNo description
PRINTSPR004041.8E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-313859IPR002100Transcription factor, MADS-box
PfamPF014867.0E-2583171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.84787177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCE AEIALIVFST RGRVYEYSNN  60
NIKATIERYK KATAETSNAC TTQELNAQFY QQESKKLRQQ IQMMQNSNRH LVGEGLSCLN  120
VRELKQLENR LERGISRIRS KKHEMILAET ENLQKREILL EQENAFLRSK IAENERLQEL  180
SMMPAPGGQE YSAIQQYLAR NMLQLNMMEG QGVSSYDPLP PPHHDKKSLE LQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S4e-20169169Myocyte-specific enhancer factor 2B
1tqe_R4e-20169169Myocyte-specific enhancer factor 2B
1tqe_Q4e-20169169Myocyte-specific enhancer factor 2B
1tqe_P4e-20169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX816510.0X81651.1 P.hybrida mRNA for MADS box containing protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006356513.11e-170PREDICTED: agamous-like MADS-box protein AGL11
SwissprotQ388362e-97AGL11_ARATH; Agamous-like MADS-box protein AGL11
TrEMBLM1A2K01e-170M1A2K0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000132481e-169(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.19e-99MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]